PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054060.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 466aa    MW: 49867.1 Da    PI: 7.0837
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054060.50genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like80.32.3e-25204255355
       G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   +++Wtp+LH++Fv+aveqL G +kA+P++ilelm+ ++L +++++SHLQkYR+
  EcC054060.50 204 KVDWTPDLHRKFVQAVEQL-GVDKAVPSRILELMGNDSLNRHNIASHLQKYRS 255
                   899****************.********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.742199258IPR017930Myb domain
SuperFamilySSF466894.84E-16200258IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-24200259IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23202256IPR006447Myb domain, plants
PfamPF002492.7E-7205254IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0005515Molecular Functionprotein binding
GO:0005524Molecular FunctionATP binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MLAVPPLREE RGDETRRGET CFSIPGAGGG GGGEDDVALF LNFSDDLLDS INFDDIFAGD  60
DALPDLEMDA AEVSTEFSTG SENQAKANPS VTWDGGGPKE LSEAEERSGS GSAAGAGAGA  120
GEPAISRSGR SKMEQEAPDL QRGCRGRXXX XXXXSSGGEG SEKKREGRSG GKRKEERDRG  180
RRSSAAAAAQ GKTNPQAQGK RKFKVDWTPD LHRKFVQAVE QLGVDKAVPS RILELMGNDS  240
LNRHNIASHL QKYRSQRRHL QSLEADAARW SKRRQIYGGA AAAGGGSKRV MTPWAAPAMG  300
FPPAPPSVHH FRPLHVWGHP TLSPSLKHGA WPLHSQPSLV PSPLPTWVPP PLLEHPPPPP  360
PLPPPDPSYW HQQGFGFAPV PGIPHHQGVY KIDPSIGVLT PLGQLASSQP SFDFHLWSES  420
VDAAIGEVLS KPWQPLPLGL KPPSLECVLG ELQRQGIASI PPASSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-15199254257ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035797.10.0PREDICTED: transcription activator GLK2-like
TrEMBLA0A059A0K20.0A0A059A0K2_EUCGR; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.16e-51GBF's pro-rich region-interacting factor 1